| 产品详情 |
Sonic Hedgehog (SHH) is one of three proteins of the Hedgehog (Hh) family, which also contains Desert Hedgehog (DHH) and Indian Hedgehog (IHH). The three members share a high degree of amino-acid sequence identity (e.g., SHH and IHH are 93 % identical). SHH is expressed in fetal intestine, liver, lung, and kidney, but not in adult tissues. The protein consists of 462 a.a. with a 23a.a. signal peptide at N-terminus, and is further cleaved into SHH N-Terminus and C-Terminus. SHH has the most critical roles in development, acting as a morphogen involved in patterning many systems, including the limb and midline structures in the brain, spinal cord, the thalamus by the zona limitans intrathalamica and the teeth. In the absence of Sonic HedgeHog, patched receptor represses the constitutive signaling activity of smoothened. SHH-N retains all known signaling capabilities, and can be lipid-modified without receptor affinity reducing, but has more potent than the unmodified form. Recombinant Human Sonic Hedgehog is a 20.0kDa protein consisting of 176 amino acid residues, including an N-terminal Ile-Val-Ile sequence substituted for the naturally occurring, chemically modified, Cys residue.
u Product Information
|
Product Name
|
Recombinant Human Sonic Hedgehog N-Terminus
(rHuSHH)
|
|
Cat. No.
|
GH137
|
|
Synonyms
|
HHG-1
|
|
Source
|
Expressed in E. coli.
|
|
Molecular weight
|
Approximately 20.0kDa, a single non-glycosylated polypeptide chain containing 176 amino acids.
|
|
Accession
|
Q15465 Cys24-Gly197(C1IVV)
|
|
AA Sequence
|
IVIGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG
|
|
Purity
|
＞97% by SDS-PAGE or HPLC.
|
|
Biological activity
|
Fully biologically active when compared to standard. The ED50 as determined by inducing alkaline phosphatase production of murine C3H/10T1/2 cells is less than 1μg/ml, corresponding to a specific activity of >1.0 ×103IU/mg.
|
|
Formulation
|
Lyophilized from a 0.2µm filtered concentrated solution in 20mMPB,150 mM NaCl, pH 7.4.
|
|
Endotoxin level
|
＜0.1EU/μg rHuSHH protein as determined by LAL method.
|
|
Reconstitution
|
Before use this product, please read the direction below carefully.
1、 This vial must be briefly centrifuged prior to opening to bring the contents to the bottom.
2、 Reconstitute in sterile distilled water or aqueous buffer containing 0.1%BSA to a concentration of 0.1-1.0mg/ml.
Stock solutions should be apportioned into working aliquots and stored at ≤-20℃. Further dilutions should be made in appropriate buffered solutions.
|
|
Storage/ Stability
|
For long term storage, the product should be stored ≤-20℃.
36 months, -20 to -70℃ as supplied.
1 month, 2 to 8℃ under sterile conditions after reconstitution;
3 months, -20 to -70℃ under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.
|
|
THIS PRODUCT IS FOR RESEARCH, LABORATORY AND EVALUATION PURPOSE ONLY.
|
|
