| 产品详情 |
GM-CSF is a hematopoietic growth factor that stimulates the development of neutrophils and macrophages, and promotes the proliferation and development of early erythroid megakaryocytic and eosinophilic progenitor cells. It is produced by endothelial cells, monocytes, fibroblasts and T-lymphocytes. GM-CSF inhibits neutrophil migration and enhances the functional activity of the mature end-cells. GM-CSF has also been reported to have a functional role on non-hematopoietic cells and can induce human endothelial cells to migrate and proliferate. Additionally, it can stimulate the proliferation of a number of tumor cell lines, including osteogenic sarcoma, carcinoma and adenocarcinoma cell lines. It is reported that GM-CSF has no biological effects across species. Recombinant Rat GM-CSF is a 14.5kDa globular protein consisting of 127 amino acid residues.
u Product Information
|
Product Name
|
Recombinant Rat Granulocyte-Macrophage Colony Stimulating Factor
(rRtGM-CSF)
|
|
Synonyms
|
Granulocyte-Macrophage Colony-Stimulating Factor, CSF-2, MGI-1GM, Pluripoietin-α
|
|
Source
|
Expressed in E. coli.
|
|
Molecular weight
|
Approximately 14.5kDa, a polypeptide chain containing 127 amino acids.
|
|
Accession
|
P48750 Ala18-Lys144
|
|
Protein amino acid sequence
|
APTRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDIISNEFSIQRPTCVQTRLKLYKQGLRGNLTKLNGALTMIASHYQTNCPPTPETDCEIEVTTFEDFIKNLKGFLFDIPFDCWKPVQK
|
|
Purity
|
＞98% by SDS-PAGE or HPLC
|
|
Formulation
|
Lyophilized from a 0.2mm filtered solution in PBS, pH 7.4.
|
|
Biological activity
|
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine FDC-P1 is less than 0.01ng/ml, corresponding to a specific activity of >1.0×108 IU/mg
|
|
Endotoxin level
|
＜0.01 EU/μg rRtGM-CSF protein
|
|
Reconstitution
|
Before use this product, please read the direction below carefully.
1、 This vial must be briefly centrifuged prior to opening to bring the contents to the bottom。
2、 Reconstitute in a sterile aqueous buffer to an appropriate concentration。
Stock solutions should be apportioned into working aliquots and stored at ≤-20 °C. Further dilutions should be made in appropriate buffered solutions。
|
|
