产品详情 |
Defensins are cationic peptides with antimicrobial activity against Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses. They are 2-6kDa proteins and take important roles in innate immune system. On the basis of their size and pattern of disulfide bonding, mammalian defensins are classified into alpha, beta and theta categories. β-Defensins contain a six-cysteine motif that forms three intra-molecular disulfide bonds. Five human β-defensins have been identified and they are expressed on some leukocytes and at epithelial surfaces. Because β-defensins is cationic peptides, they can therefore interact with the membrane of invading microbes, which are negative due to lipopolysaccharides (LPS) and lipoteichoic acid (LTA) found in the cell membrane. Especially, they have higher affinity to the binding site compared to Ca2+ and Mg2+ ions. Furthermore, they can affect the stability of the membrane. Recombinant Human BD-4 is a 6.0kDa non-glycosylated protein containing 50 amino acid residues.
u Product Information
Product Name
|
Recombinant Human Beta-defensin 4
(rHuBD-4)
|
Synonyms
|
Defensin beta4
|
Source
|
Expressed in E. coli.
|
Molecular weight
|
Approximately 6.0kDa, a single non-glycosylated polypeptide chain containing 50 amino acids.
|
Accession
|
Q8WTQ1 Glu23-Pro72
|
AA Sequence
|
EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRTKP
|
Purity
|
>98% by SDS-PAGE or HPLC.
|
Biological activity
|
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 0.1-100ng/ml.
|
Formulation
|
Lyophilized from a 0.2µm filtered concentrated solution in 20mM PB, 150mM NaCl, pH7.4.
|
Endotoxin level
|
<0.01EU/μg rHuBD-4 protein as determined by LAL method.
|
Reconstitution
|
Before use this product, please read the direction below carefully.
1、 This vial must be briefly centrifuged prior to opening to bring the contents to the bottom.
2、 Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0mg/ml.
Stock solutions should be apportioned into working aliquots and stored at ≤-20℃. Further dilutions should be made in appropriate buffered solutions.
|
Storage/ Stability
|
For long term storage, the product should be stored ≤-20℃
36 months, -20 to -70℃ as supplied.
1 month, 2 to 8℃ under sterile conditions after reconstitution;
3 months, -20 to -70℃ under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.
|
THIS PRODUCT IS FOR RESEARCH, LABORATORY AND EVALUATION PURPOSE ONLY.
|
|