| 产品详情 |
Vascular Endothelial Growth Factor is a sub-family of growth factors produced by cells, which stimulates vasculogenesis and angiogenesis. VEGF's normal function is to create new blood vessels during embryonic development, new blood vessels after injury, muscle following exercise, and new vessels (collateral circulation) to bypass blocked vessels. VEGF production can be induced in cells that are not receiving enough oxygen. VEGF165 appears to be the most abundant and potent isoform, followed by VEGF121 and VEGF189. In addition, it shares 88 % a.a. with corresponding regions of mouse and rat, 96 % with porcine, 95 % with canine, and 93 % with feline, equine and bovine VEGF, respectively. Recombinant human VEGF165 contains 165 amino acids residues and it is a disulfide-linked homodimer.
u Product Information
|
Product Name
|
Recombinant Human Vascular Endothelial Growth Factor 165
(rHuVEGF165)
|
|
Source
|
Expressed in E. coli.
|
|
Molecular weight
|
Approximately 38.2Da, a disulfide-linked homodimeric protein consisting of two 165 amino acid polypeptide chains.
|
|
Accession
|
P15692 Ala27-Arg191 with an N-terminal Methionine
|
|
AA Sequence
|
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
|
|
Purity
|
＞96% by SDS-PAGE or HPLC.
|
|
Biological activity
|
Fully biologically active when compared to standard. Determined by the dose-dependent stimulation of the proliferation of human umbilical vein endothelial cells (HUVEC) using a concentration range of 1.0-8.0 ng/ml.
|
|
Formulation
|
Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4.
|
|
Endotoxin level
|
＜0.01 EU/μg rHuVEGF165 protein as determined by LAL method.
|
|
Reconstitution
|
Before use this product, please read the direction below carefully.
1、 This vial must be briefly centrifuged prior to opening to bring the contents to the bottom.
2、 Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0mg/ml.
Stock solutions should be apportioned into working aliquots and stored at ≤-20℃. Further dilutions should be made in appropriate buffered solutions.
|
|
Storage/ Stability
|
For long term storage, the product should be stored ≤-20℃.
36 months, -20 to -70℃ as supplied.
1 month, 2 to 8℃ under sterile conditions after reconstitution;
3 months, -20 to -70℃ under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.
|
|
THIS PRODUCT IS FOR RESEARCH, LABORATORY AND EVALUATION PURPOSE ONLY.
|
|
