| 产品详情 |
Interleukin-4 (IL-4) is a pleiotropic cytokine that induces differentiation of naive helper T cells (Th0 cells) to Th2 cells. It is produced by mast cells, activated T cells and bone marrow stromal cells. It has many biological roles, including the stimulation of activated B-cell and T-cell proliferation, and the differentiation of CD4+ T-cells into Th2 cells. In addition, IL-4 enhances both secretion and cell surface expression of IgE and IgG1 and also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. IL-4 plays a dominant role in the development of allergic inflammation and asthma. The mouse IL-4 has a compact, globular fold, stabilized by three disulfide bonds. The human IL-4 shares about 40% aa sequence identity with mouse/rat IL-4 and they are species-specific in their activities. Recombinant Murine IL-4 is a 13.5kDa globular protein consisting of 121 amino acid residues.
Product Information
|
Product Name
|
Recombinant murine Interleukin-4
(rMuIL-4)
|
|
Synonyms
|
B-cell IgG differentiation factor, B-cell growth factor 1, BSF-1, IGG1 induction factor, Lymphocyte stimulatory factor 1
|
|
Source
|
Expressed in E. coli.
|
|
Molecular weight
|
Approximately 13.5kDa, a single non-glycosylated polypeptide chain containing 121 amino acids.
|
|
Accession
|
P07750 His21-Ser140 with an N-terminal methionine
|
|
AA Sequence
|
MHIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS
|
|
Purity
|
＞97% by SDS-PAGE or HPLC
|
|
Formulation
|
Lyophilized from a 0.2mm filtered solution in PBS, pH 7.4.
|
|
Biological activity
|
Fully biologically active when compared to standard. The ED50 as determined by the dose-dependent proliferation of Murine HT-2 cells is less than 2ng/ml, corresponding to a specific activity of >5×105 IU/mg.
|
|
Endotoxin level
|
Less than 0.1EU/mg of rMuIL-4 as determined by LAL method
|
|
Reconstitution
|
Before use this product, please read the direction below carefully.
1、 This vial must be briefly centrifuged prior to opening to bring the contents to the bottom.
2、 Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0mg/ml.
Stock solutions should be apportioned into working aliquots and stored at ≤ -20℃.
Further dilutions should be made in appropriate buffered solutions.
|
|
Storage/ Stability
|
For long term storage, the product should be stored ≤-20℃.
36 months, -20 to -70℃ as supplied.
1 month, 2 to 8℃ under sterile conditions after reconstitution;
3 months, -20 to -70℃ under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.
|
|
THIS PRODUCT IS FOR RESEARCH, LABORATORY AND EVALUATION PURPOSE ONLY.
|
|
