| 产品详情 |
Epidermal Growth Factor was originally discovered in crude preparations of nerve growth factor prepared from mouse submaxillary glands as an activity that induced early eyelid opening, incisor eruption, hair growth inhibition, and stunting of growth when injected into newborn mice. It is prototypic of a family of growth factors that are derived from membrane-anchored precursors. All members of this family are characterized by the presence of at least one EGF structural unit (defined by the presence of a conserved 6 cysteine motif that forms three disulfide bonds) in their extracellular domain. EGF is initially synthesized as a 130kDa precursor transmembrane protein containing 9 EGF units. The mature soluble EGF sequence corresponds to the EGF unit located proximal to the transmembrane domain. The membrane EGF precursor is capable of binding to the EGF receptor and was reported to be biologically active. Mature mouse EGF shares 70% a.a. sequence identity with mature human EGF. Additionally, EGF has been shown to inhibit gastric secretion, and to be involved in wound healing. EGF signals through a receptor known as c-erbB, which is a class I tyrosine kinase receptor. This receptor also binds with TGF-α and VGF. Recombinant Murine EGF is a 6.0kDa globular protein containing 53 amino acid residues, including 3 intramolecular disulfide bonds.
u Product Information
|
Product Name
|
Recombinant Murine Epidermal Growth Factor protein
(rMuEGF)
|
|
Synonyms
|
Urogastrone, URG
|
|
Source
|
Expressed in E. coli.
|
|
Molecular weight
|
Approximately 6.0kDa, a single non-glycosylated polypeptide chain containing 53 amino acids.
|
|
Accession
|
P01132 Asn977-Arg1029
|
|
AA Sequence
|
NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR
|
|
Purity
|
＞97% by SDS-PAGE or HPLC
|
|
Formulation
|
Lyophilized from a 0.2μm filtered solution in PBS pH7.4.
|
|
Biological activity
|
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine Balb/c 3T3 cells is less than 0.1ng/ml, corresponding to a specific activity of > 1.0 ×107IU/mg.
|
|
Endotoxin level
|
＜0.1EU/μg rMuEGF protein as determined by LAL method.
|
|
Reconstitution
|
Before use this product, please read the direction below carefully.
1、 This vial must be briefly centrifuged prior to opening to bring the contents to the bottom.
2、 Reconstitute in sterile distilled water or aqueous buffer containing 0.1%BSA to a concentration of 0.1-1.0mg/ml.
Stock solutions should be apportioned into working aliquots and stored at ≤-20℃. Further dilutions should be made in appropriate buffered solutions.
|
|
Storage/ Stability
|
White lyophilized powder. For long term storage, the product should be stored ≤-20℃. Please avoid repeated freeze-thaw cycles after reconstitution.
12 months from date of receipt, -20 to -70℃ as supplied.
1 month, 2 to 8℃ under sterile conditions after reconstitution.
3 months, -20 to -70℃ under sterile conditions after reconstitution.
|
|
THIS PRODUCT IS FOR RESEARCH, LABORATORY AND EVALUATION PURPOSE ONLY.
|
|
